PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK20135.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 352aa    MW: 39494.5 Da    PI: 8.5496
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK20135.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.51.8e-51141391128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrF Ptdeel+v+yL++kv+g++++l e+i e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ +g++v
  PK20135.1  14 LPPGFRFFPTDEELLVQYLCRKVAGHHFSL-EIIGEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITT-EGRKV 111
                79***************************9.99***************7777799***********************************9999.999** PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kk Lvfy g+apkg+kt+W+mheyrl
  PK20135.1 112 GIKKALVFYVGKAPKGTKTNWIMHEYRL 139
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-669162IPR003441NAC domain
PROSITE profilePS5100559.87314162IPR003441NAC domain
PfamPF023651.1E-2515139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGVPEMDPLS QLSLPPGFRF FPTDEELLVQ YLCRKVAGHH FSLEIIGEID LYKFDPWVLP  60
SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIITTEGRK VGIKKALVFY  120
VGKAPKGTKT NWIMHEYRLI EPSRKNGSTK LDEWVLCRIY KKSSGSQNKQ MMMASPMSKE  180
HSNGSSSSSS SHLDDVLDSL PAIDDRFFNL PRVNSLKTLH QQGDEKLGFL NLGSGNFDWA  240
TLAALNSVPE LVPGNQASQP QQCTGTVGYN NNDMFVPSSI PPLCHVDQSP PKNKLENSMD  300
EEVQSGLRNS QRIDNSGFYQ TNSNVLTQNY SNSLDPYGFR YPAHSAGFGF RQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D1e-11011687174NAC domain-containing protein 19
3swp_C1e-11011687174NAC domain-containing protein 19
3swp_B1e-11011687174NAC domain-containing protein 19
3swp_A1e-11011687174NAC domain-containing protein 19
3swm_D1e-11011687174NAC domain-containing protein 19
3swm_C1e-11011687174NAC domain-containing protein 19
3swm_B1e-11011687174NAC domain-containing protein 19
3swm_A1e-11011687174NAC domain-containing protein 19
4dul_B1e-11011684171NAC domain-containing protein 19
4dul_A1e-11011684171NAC domain-containing protein 19
1ut7_B1e-11011684171NO APICAL MERISTEM PROTEIN
1ut7_A1e-11011684171NO APICAL MERISTEM PROTEIN
1ut4_B1e-11011684171NO APICAL MERISTEM PROTEIN
1ut4_A1e-11011684171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010089503.10.0NAC domain-containing protein 72
SwissprotQ93VY31e-136NAC72_ARATH; NAC domain-containing protein 72
TrEMBLW9QI390.0W9QI39_9R
STRINGVIT_19s0014g03290.t011e-171(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44293360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-129NAC family protein